PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02684.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 491aa    MW: 53361.8 Da    PI: 7.1111
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02684.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rgrWT+eEde l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc02684.1.g00010.1.am.mk 14 RGRWTAEEDEVLASYIAKHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                                  89******************************99************97 PP

2Myb_DNA-binding285.2e-092072302448
                                   HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  24 WktIartmgkgRtlkqcksrwqkyl 48 
                                   W++Ia++++ gRt++++k++w+++l
  Zmw_sc02684.1.g00010.1.am.mk 207 WSLIASHLP-GRTDNEIKNYWNSHL 230
                                   *********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-22569IPR009057Homeodomain-like
PROSITE profilePS5129422.044965IPR017930Myb domain
SMARTSM007172.8E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
SuperFamilySSF466897.89E-211588IPR009057Homeodomain-like
CDDcd001671.70E-101661No hitNo description
SMARTSM007178.5E-1066232IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-177087IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-17206230IPR009057Homeodomain-like
SuperFamilySSF466894.02E-7206235IPR009057Homeodomain-like
PfamPF002491.1E-6207230IPR001005SANT/Myb domain
CDDcd001671.26E-6207230No hitNo description
PROSITE profilePS500906.632207230IPR017877Myb-like domain
PfamPF066404.3E-64248468IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEVLASYIA KHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI SKEEEDIIIK LHATLGNRAG RMESTAGGQL ASMVITADRL TEEPISINLL  120
GAVGARVRRV HSLLLLLLLA CHAVTLEATR VAHAWHGMAC SPDHLTPPSS RFVKYSGFTD  180
HRQGSVKRAV PSGVTFPLAR SLSVVPWSLI ASHLPGRTDN EIKNYWNSHL SRQIHTYRRI  240
YTAGNDTTIT IDITKLHSQE KRRGGRTPGR SRKSRDKITT SRGKRADPEP EPAEQSGKLE  300
KRVDASSPVA AMSSPPQSDD GARSAVVDPD GPNQRTNSVD VDGNTPGHGG PCSEDATGPV  360
EMEPLDIGLW EAESEMDMEA LLLSTTGTGS IGDGSGSFAT GLVDAVGEAP VDDLLDMDWD  420
GFAAHLWGDP GQNEQNDHRG TAQAAEPRAA AGCDPEPEEL ESFATWLLRT RRTCTHVSRR  480
FFVERHPGVS G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984641.16e-72PREDICTED: myb-related protein P-like
SwissprotP278985e-52MYBP_MAIZE; Myb-related protein P
TrEMBLK4AKW06e-72K4AKW0_SETIT; Uncharacterized protein
STRINGSi039538m2e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563